Analytical Data
-
Gene name
COL4a4
- Application
-
Alternative Names
COL4a4；Collagen alpha-4(IV) chain
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P02462
-
Expression Region
30-167aa
-
AA Sequence
GCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPQGPPGQKGDTGEPGLPGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGERGPLGPPGLPGFAGNPGPPGLPGMKGDPGEILGHVP
-
Molecular Weight
39.9kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
COL4A4, a gene encoding the alpha 4 chain of type IV collagen, plays a crucial role in the structural integrity of basement membranes throughout the body, particularly in the kidneys, eyes, and ears. Mutations in COL4A4 are linked to various inherited diseases, such as Alport syndrome, which is characterized by progressive renal failure, hearing loss, and ocular abnormalities due to defects in the type IV collagen network. The study of COL4A4 recombinant proteins is pivotal for understanding the molecular mechanisms underlying these disorders, as well as for the development of potential therapeutic strategies. By producing and characterizing recombinant COL4A4 proteins, researchers can investigate the impact of specific mutations on protein structure and function, elucidate the pathophysiological pathways involved in related diseases, and explore the potential for gene therapy or protein replacement therapies. Furthermore, the study of COL4A4 recombinant proteins could facilitate the development of biomarkers for early diagnosis and monitoring of related conditions, highlighting its significance in both clinical and research contexts.
