Analytical Data
-
Gene name
ENAM
- Application
-
Alternative Names
ENAM；Enamelin
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NRM1
-
Expression Region
1043-1142aa
-
AA Sequence
ERQQQRPSNILHLPCFGSKLAKHHSSTTGTPSSDGRQSPFDGDSITPTENPNTLVELATEEQFKSINVDPLDADEHSPFEFLQRGTNVQDQVQDCLLLQA
-
Molecular Weight
18.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ENAM (enamelin) is a significant structural protein involved in the formation of dental enamel, providing strength and durability to teeth. The research surrounding ENAM is driven by its critical role in amelogenesis (the process of enamel formation) and its influence on dental health. Mutations in the ENAM gene have been linked to various dental disorders, including enamel hypoplasia and other developmental anomalies, which can lead to increased susceptibility to caries and sensitivity. Understanding the biochemical functions and mechanisms of ENAM is crucial, as it not only aids in clarifying the etiologies of enamel defects but also offers potential insights into innovative therapeutic strategies for dental restoration and regenerative approaches. Moreover, harnessing recombinant techniques to produce ENAM allows for in-depth studies on its structural characteristics, interactions with other proteins, and its role in enamel matrix development. Such research is pivotal in enhancing our knowledge of enamel biology, paving the way for advances in dental treatments and preventive measures against enamel-related dental conditions. As we delve deeper into the molecular mechanisms involving ENAM, the potential for translational applications in dentistry continues to expand, highlighting its importance in both health and disease.
