Analytical Data
-
Gene name
PO5F1
- Application
-
Alternative Names
POU5F1;OCT3;OCT4;OTF3;POU domain. class 5. transcription factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q01860
-
Expression Region
1-360aa
-
AA Sequence
MAGHLASDFAFSPPPGGGGDGPGGPEPGWVDPRTWLSFQGPPGGPGIGPG VGPGSEVWGIPPCPPPYEFCGGMAYCGPQVGVGLVPQGGLETSQPEGEAG VGVESNSDGASPEPCTVTPGAVKLEKEKLEQNPEESQDIKALQKELEQFA KLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTICRFEALQLSFKNMCKL RPLLQKWVEEADNNENLQEICKAETLVQARKRKRTSIENRVRGNLENLFL QCPKPTLQQISHIAQQLGLEKDVVRVWFCNRRQKGKRSSSDYAQREDFEA AGSPFSGGPVSFLLAPGPHFGTPGYGSPHFTALYSSVPFPEGEAFPPVSV TTLGSPMHSNTSRSEPSGPISTGNPSPPSKESHKSPTDVSLGDELHLDGE DVAMAHADALDDFDLDMLGDGDSPGPGFTPHDSAPYGALDMADFEFEQMF TDALGIDEYGGLEESGGGGSPGRRRRRRRRRRR
-
Molecular Weight
52 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The study of recombinant protein 45934 has gained attention in the field of molecular biology and biotechnology due to its potential applications in therapeutics and diagnostics. Recombinant proteins are artificially produced proteins that are synthesized using recombinant DNA technology, which enables the insertion of specific genes into host cells, typically bacteria or yeast. This technological advancement allows for large-scale production and purification of proteins that may have important biological functions. The research background of 45934 revolves around its unique structural and functional properties, which may be pivotal in understanding certain biological processes or in the development of novel treatments for diseases. Additionally, investigations into the protein’s interactions with other biomolecules have the potential to reveal critical insights into disease mechanisms or cellular pathways. Furthermore, the successful expression and characterization of recombinant 45934 open avenues for its use in vaccine development, enzyme replacement therapies, or as therapeutic agents targeting specific diseases. Critical to this research is the exploration of the protein's stability, activity, and immunogenicity, which are essential parameters for its practical applications. As the field progresses, the study of recombinant proteins like 45934 not only contributes to fundamental science but also holds promise for innovative approaches to healthcare solutions. This comprehensive understanding of its biology could lead to breakthroughs in treatment methodologies, enhancing the efficacy and specificity of therapeutic interventions. Overall, the ongoing research on recombinant protein 45934 underscores the significance of protein engineering in modern biomedical research and its potential impact on health and disease management.
