Analytical Data
-
Gene name
NFKBID
- Application
-
Alternative Names
NFKBID;IKBNS;NF-kappa-B inhibitor delta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NI38
-
Expression Region
1-313aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMEAGPWRVSAPPSGPPQFPAVVPGPSL EVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQVYRR LDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAAT YGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRV LSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLL ELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLR NLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS
-
Molecular Weight
36 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NFKBID, or NF-kappaB inhibitor δ, is a member of the NF-kappaB inhibitory protein family, playing a crucial role in regulating immune responses and maintaining cellular homeostasis. Research into NFKBID has gained significance due to its involvement in various physiological processes and pathological conditions, including inflammation, cancer, and autoimmune diseases. The NF-kappaB signaling pathway is critical for cell survival, proliferation, and differentiation, and the regulation of this pathway by NFKBID is essential for preventing excessive activation that can lead to disease. Recent studies have highlighted the potential of NFKBID as a therapeutic target, with promising implications for developing interventions that manipulate the NF-kappaB pathway in disease contexts. Moreover, the recombinant expression of NFKBID facilitates detailed functional studies, allowing researchers to explore its molecular mechanisms and interactions with other signaling components. Understanding the structure and function of NFKBID is vital for deciphering its role in disease pathology and for identifying novel treatment strategies that could mitigate the adverse effects of dysregulated NF-kappaB activity. As researchers continue to investigate the implications of NFKBID in different biological contexts, the recombinant protein's study offers a pathway to uncover new insights into its function and therapeutic potential.











