Analytical Data
-
Gene name
LOC388272
- Application
-
Alternative Names
C16orf87; Chromosome 16 open reading frame 87; CP087_HUMAN; Hypothetical protein LOC388272; MGC62018; UPF0547 protein C16orf87
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6PH81
-
Expression Region
1-154aa
-
AA Sequence
MSATRAKKVKMATKSCPECDQQVPVACKSCPCGYIFISRKLLNAKHSEKSPPSTENKHEAKRRRTERVRREKINSTVNKDLENRKRSRSNSHSDHIRRGRGRPKSASAKKHEEEREKQEKEIDIYANLSDEKAFVFSVALAEINRKIINQRLIL
-
Molecular Weight
44.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LOC388272 is a gene of interest due to its potential role in various biological processes and diseases, although its exact function remains largely uncharacterized. Recent studies have suggested that LOC388272 may be involved in cellular signaling pathways and could play a role in cancer progression and inflammatory responses. The research on LOC388272 gained momentum as scientists sought to identify the specific mechanisms by which this gene influences cellular functions. Recombinant protein studies are particularly valuable for elucidating the characteristics and interactions of LOC388272, as they allow for the expression and purification of this protein in controlled laboratory settings. By analyzing the recombinant LOC388272 protein, researchers aim to determine its structure, functional properties, and potential interactions with other biomolecules, which could shed light on its biological significance. This knowledge could ultimately lead to the development of novel therapeutic strategies targeting diseases associated with LOC388272 dysregulation. Additionally, understanding the role of LOC388272 in various tissue types may provide insights into its involvement in developmental processes and its potential as a biomarker for disease diagnosis or prognosis. Overall, the exploration of LOC388272 through recombinant protein studies represents a promising avenue for advancing our understanding of its biological role and implications in health and disease.











