Analytical Data
-
Gene name
U51
- Application
-
Alternative Names
U51；
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P52542
-
Expression Region
1-301aa
-
AA Sequence
MEKETKSLAWPATAEFYGWVFIFSSIQLCTVVFLTVRFNGFKVGREYAVFTFAGMSFNCFLLPIKMGLLSGHWTLPRDFCAILLYIDDFSAYFSSWSLVFMAIERINYFCYSTPLLNENSKALAKVCFPIVWVVSGVQALQMLNNYKATALQNETGQCFLAFLRSGHDMWLMLVYSVVIPVMLVFFYLYSKNFMLLKDELSSVTTYLCIYLLLGTIAHLPKAALSEIESDKIFYGLRDIFMALPVLKVYYISAMAYCMACDDHTVPVRLCSIWLVNLCKKCFSCTRREKGSDLEVGIKMLK
-
Molecular Weight
37.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
U51 recombinant protein research has emerged as a significant area of focus within molecular biology and biotechnology due to its potential applications in vaccine development and therapeutic interventions. U51, derived from specific viral or bacterial strains, plays a crucial role in eliciting immune responses, making it a candidate for further study in the context of infectious diseases. The protein's ability to stimulate both humoral and cell-mediated immune responses poses exciting opportunities for creating effective vaccines against pathogens that pose global health threats. Additionally, understanding the structural and functional properties of U51 can aid in deciphering the mechanisms of immune evasion employed by pathogens, thereby providing insights into novel therapeutic strategies. With advancements in recombinant DNA technology, the production and purification of U51 have become more feasible, allowing researchers to explore its applications in immunology and therapeutic development more comprehensively. As researchers delve deeper into the characterization and functional analysis of U51, its implications in designing next-generation vaccines and therapeutics could significantly contribute to combating emerging infectious diseases and enhance global health security.
