Analytical Data
-
Gene name
ACH
- Application
-
Alternative Names
ACH；NACHRA10；Neuronal acetylcholine receptor subunit alpha-10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P22607-1
-
Expression Region
23-375aa
-
AA Sequence
ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAEEELVEADEAGSVYAG
-
Molecular Weight
40.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACH (Acetylcholinesterase) recombinant proteins have garnered significant attention in the field of biochemistry and molecular biology due to their critical role in neurotransmission and potential applications in various therapeutic areas. Acetylcholinesterase is an essential enzyme that hydrolyzes the neurotransmitter acetylcholine in the synaptic cleft, thus playing a pivotal role in muscle contraction and nerve impulse transmission. The dysfunction of this enzyme is associated with several neurological disorders, including Alzheimer's disease and myasthenia gravis. Researchers have sought to produce recombinant forms of ACH to better understand its biochemical properties, investigate its structure-function relationships, and explore its potential as a therapeutic target. Advances in genetic engineering and recombinant DNA technology have made it feasible to produce large quantities of functional ACH proteins in model organisms or cell cultures. These recombinant proteins not only serve as valuable tools for studying enzyme kinetics and regulation but also hold promise for developing novel drugs or enzyme replacement therapies. As the demand for biopharmaceuticals continues to grow, the study of recombinant ACH proteins is pivotal in addressing medical challenges related to cholinergic dysfunctions and enhancing our understanding of neurodegenerative diseases.
