Cat: PA2000-4837

Recombinant Human U12 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    U12

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    U12;KIAA1839;RBM40;RNP;RNA-binding region-containing Protein 3

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P52380

  • Expression Region

    1-347aa

  • AA Sequence

    MDTVIELSKLQFKGNASCTSTPTLKTARIMESAVTGITLTTSIPMIIIVVTTMILYHRVAKHNATSFYVITLFASDFVLMWCVFFMTVNRKQLFSFNRFFCQLVYFIYHAVCSYSISMLAIIATIRYKTLHRRKKTESKTSSTGRNIGILLLASSMCAIPTALFVKTNGMKKTGKCVVYISSKKAYELFLAVKIVFSFIWGVLPTMVFSFFYVIFCKALHDVTEKKYKKTLFFIRILLLSFLLIQIPYIAILICEIAFLYMPQNTCFWLARVEILQLIIRLMPQVHCFSNPLVYAFTGGELRNRFTACFQSFFPKTLCSTQKRKDSDASEHDQNSKSKASVEKNQPL

  • Molecular Weight

    42.6 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

U12 pre-mRNA is a component of the spliceosomal machinery responsible for the processing of non-canonical introns, distinct from the more common U2-type introns. The study of U12 and its associated proteins is crucial due to their implications in gene expression regulation and potential links to various diseases, including certain cancers and genetic disorders. U12 splicing is particularly interesting because it involves a unique set of snRNPs and spliceosomal components, making it a central focus for understanding the evolution of splicing mechanisms in eukaryotes. Recent advances in structural biology and computational methods have enabled researchers to dissect the functional roles of U12-associated proteins and their interactions within the spliceosome, thus opening up avenues for therapeutic interventions. Additionally, exploring U12-independent splicing pathways can provide insights into synthetic biology applications and biotechnological innovations. Understanding the functional dynamics of U12 spliceosomal components may lead to novel strategies for manipulating splicing events, advancing both basic research in molecular biology and applications in medical science.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US