Analytical Data
-
Gene name
LINC00478
- Application
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A1L4M7
-
Expression Region
1-104aa
-
AA Sequence
MEIILELQQSAQLHNREAGTQIDRQISQLVEGASGWQLWAFGCWTTIGKTEMEQGQKIAHFYSTQLLLFHDLQEFYWDNYPNKLQAFYPNGALSEMKRILNVKI
-
Molecular Weight
11.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LINC00478, a long intergenic non-coding RNA (lncRNA), has garnered significant attention in recent years due to its potential roles in various biological processes and disease mechanisms. Research indicates that LINC00478 is involved in regulating gene expression, influencing cell proliferation, and modulating apoptosis. Its aberrant expression has been associated with several types of cancers, including breast, lung, and liver cancer, suggesting it may serve as a potential biomarker for tumor diagnosis and prognosis. The study of LINC00478 recombinant proteins offers a promising avenue for elucidating its functional mechanisms and interactions at the molecular level. By creating recombinant versions of the LINC00478 protein, researchers aim to investigate its structural properties, binding affinities, and downstream effects on cellular pathways. This research could lead to a better understanding of how LINC00478 contributes to cancer development and progression, potentially identifying therapeutic targets or strategies to counteract its oncogenic effects. Overall, LINC00478's involvement in critical cellular processes and its association with malignancies underscore the importance of studying its recombinant protein to unlock new insights into RNA biology and cancer therapeutics.
