Cat: PA2000-8913

Recombinant Human LINC00478 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LINC00478

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A1L4M7

  • Expression Region

    1-104aa

  • AA Sequence

    MEIILELQQSAQLHNREAGTQIDRQISQLVEGASGWQLWAFGCWTTIGKTEMEQGQKIAHFYSTQLLLFHDLQEFYWDNYPNKLQAFYPNGALSEMKRILNVKI

  • Molecular Weight

    11.5 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LINC00478, a long intergenic non-coding RNA (lncRNA), has garnered significant attention in recent years due to its potential roles in various biological processes and disease mechanisms. Research indicates that LINC00478 is involved in regulating gene expression, influencing cell proliferation, and modulating apoptosis. Its aberrant expression has been associated with several types of cancers, including breast, lung, and liver cancer, suggesting it may serve as a potential biomarker for tumor diagnosis and prognosis. The study of LINC00478 recombinant proteins offers a promising avenue for elucidating its functional mechanisms and interactions at the molecular level. By creating recombinant versions of the LINC00478 protein, researchers aim to investigate its structural properties, binding affinities, and downstream effects on cellular pathways. This research could lead to a better understanding of how LINC00478 contributes to cancer development and progression, potentially identifying therapeutic targets or strategies to counteract its oncogenic effects. Overall, LINC00478's involvement in critical cellular processes and its association with malignancies underscore the importance of studying its recombinant protein to unlock new insights into RNA biology and cancer therapeutics.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US