Analytical Data
-
Gene name
NAIF1
- Application
-
Alternative Names
NAIF1;C9orf90;Nuclear apoptosis-inducing factor 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q69YI7
-
Expression Region
1-327aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMAVPAKKRKMNFSEREVEIIVEELELK KHLLVNHFNAGVPLAAKSAAWHGILRRVNAVATCRRELPEVKKKWSDLKT EVRRKVAQVRAAVEGGEAPGPTEEDGAGGPGTGGGSGGGGPAVAPVLLTP MQQRICNLLGEATIISLPSTTEIHPVALGPSATAAAATVTLTQIPTETTY HTLEEGVVEYCTAEAPPPLPPETPVDMMAQHADTSVKPQALKSRIALNSA KLIQEQRVTNLHVKEIAQHLEQQNDLLQMIRRSQEVQACAQERQAQAMEG TQAALSVLIQVLRPMIKDFRRYLQSNTANPAPASDPGQVAQNGQPDSIIQ
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NAIF1 (Nuclear Autoantigenic Peptide 1) is a protein associated with several critical biological processes, particularly in the context of cellular proliferation and immune responses. Originally identified in studies related to autoimmune diseases, NAIF1 has garnered attention due to its role in influencing the immune system by regulating the expression of various cytokines and chemokines. Researchers have linked aberrant NAIF1 expression to conditions such as cancer, where it may contribute to tumor progression and metastasis. The demand for understanding NAIF1's structure and function has increased as scientists aim to elucidate its mechanisms of action and potential clinical implications. Recent studies have focused on the recombinant expression of NAIF1 in various expression systems to facilitate biophysical characterization and functional studies. By producing this protein in a controlled laboratory setting, researchers aim to dissect its interactions with other cellular components and its impact on the immune landscape. Investigating NAIF1's pathways could provide insights into novel therapeutic targets, especially in oncology and autoimmune disorders, thereby highlighting its relevance in both basic research and clinical applications. As such, the study of NAIF1 can inform the development of innovative treatments that target its regulatory functions, paving the way for advances in disease management and therapeutic strategies.











