Analytical Data
-
Gene name
MyD88
- Application
-
Alternative Names
MYD88;Myeloid differentiation primary response Protein MyD88
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99836
-
Expression Region
31-130aa
-
AA Sequence
RRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQG RPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQ
-
Molecular Weight
37 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MyD88, or Myeloid Differentiation Primary Response 88, is a crucial adapter protein in the innate immune system, playing a pivotal role in the signaling pathways of Toll-like receptors (TLRs) and interleukin-1 receptors (IL-1Rs). It facilitates the activation of transcription factors such as NF-κB and mitogen-activated protein kinases (MAPKs), leading to the expression of pro-inflammatory cytokines and chemokines. The research on recombinant MyD88 protein has gained traction due to its potential implications in understanding immune responses, pathogenesis of infectious diseases, and autoimmune disorders. Given its central role in mediating inflammatory signals, MyD88 is also a promising target for therapeutic interventions. Recombinant expression systems allow for the production of MyD88 in various forms, enabling detailed studies into its functional domains, interactions with other proteins, and its role in various cellular processes. Understanding how MyD88 operates at the molecular level can provide insights into designing novel immunomodulatory therapies and improving vaccine strategies. Furthermore, manipulating MyD88 signaling pathways has therapeutic potential in managing conditions characterized by excessive inflammation or immune dysregulation, making it a focal point in contemporary immunology research. Thus, the exploration of MyD88 and its recombinant forms represents a significant avenue for advancing our knowledge of innate immunity and developing innovative clinical applications.
