Analytical Data
-
Gene name
IAA7
- Application
-
Alternative Names
IAA7；AXR2；Auxin-responsive Protein IAA7
-
Species
Arabidopsis thaliana
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q38825
-
Expression Region
1-243aa
-
AA Sequence
MIGQLMNLKATELCLGLPGGAEAVESPAKSAVGSKRGFSETVDLMLNLQSNKEGSVDLKNVSAVPKEKTTLKDPSKPPAKAQVVGWPPVRNYRKNMMTQQKTSSGAEEASSEKAGNFGGGAAGAGLVKVSMDGAPYLRKVDLKMYKSYQDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMNLLNSSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSEAVGLAPRAMEKYCKNRS
-
Molecular Weight
33.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
IAA7, a member of the Auxin/Indole-3-Acetic Acid (AUX/IAA) protein family, plays a critical role in plant hormone signaling, particularly in auxin response pathways. This family of proteins is characterized by their rapid degradation in the presence of auxin, which allows for the modulation of gene expression related to growth and development. IAA7, in particular, is known for its functions in regulating processes such as root development, lateral root formation, and leaf abscission. Research on IAA7 has gained momentum due to its implications in plant adaptation to environmental changes and stress responses, as well as its potential applications in agricultural biotechnology. Recent studies have employed various techniques, including gene expression analysis, protein interaction assays, and CRISPR-Cas9 gene editing, to elucidate the mechanistic pathways through which IAA7 operates. Understanding the role of IAA7 in auxin signaling not only contributes to our knowledge of fundamental plant biology but also holds promise for improving crop resilience and yield in the face of climate change and other challenges. As a result, IAA7 has emerged as a key focus of research aimed at deciphering the intricate regulatory networks governing plant growth and development, with the potential for applications in enhancing agricultural practices.
