Analytical Data
-
Gene name
CAM4
- Application
-
Alternative Names
CAM4;Caffeoyl-CoA O-methyltransferase 1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DH96
-
Expression Region
1-149aa
-
AA Sequence
MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK
-
Molecular Weight
24.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
CAM4, a member of the antimicrobial peptide family, has garnered significant attention in recent years due to its potential therapeutic applications. Antimicrobial peptides are key components of the innate immune system, known for their ability to combat a wide range of pathogens, including bacteria, viruses, and fungi. Research into CAM4 has shown that it possesses unique properties, including a broad-spectrum antimicrobial activity and a relatively low propensity for developing resistance in target microorganisms. This is particularly important in the context of rising antibiotic resistance, where alternative treatment strategies are urgently needed. Studies have demonstrated that CAM4 not only exhibits direct antimicrobial properties but also has immunomodulatory effects, which could enhance the host's immune response. Furthermore, the ability to recombinantly express CAM4 allows for large-scale production and facilitates further studies into its structure-function relationship, paving the way for the development of novel therapeutic agents. Understanding the mechanisms through which CAM4 operates will provide insights into its potential as a drug candidate and its applications in areas such as wound healing, infection control, and even cancer therapy. As researchers continue to explore the biochemical properties and potential applications of CAM4, it stands as a promising candidate in the search for new, effective treatment modalities against resistant infections and other related diseases.











