Cat: PA2000-4761

Recombinant E.coli CAM4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CAM4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CAM4;Caffeoyl-CoA O-methyltransferase 1

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P0DH96

  • Expression Region

    1-149aa

  • AA Sequence

    MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMAKKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVEEMIREADVDGDGQINYEEFVKIMMAK

  • Molecular Weight

    24.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

CAM4, a member of the antimicrobial peptide family, has garnered significant attention in recent years due to its potential therapeutic applications. Antimicrobial peptides are key components of the innate immune system, known for their ability to combat a wide range of pathogens, including bacteria, viruses, and fungi. Research into CAM4 has shown that it possesses unique properties, including a broad-spectrum antimicrobial activity and a relatively low propensity for developing resistance in target microorganisms. This is particularly important in the context of rising antibiotic resistance, where alternative treatment strategies are urgently needed. Studies have demonstrated that CAM4 not only exhibits direct antimicrobial properties but also has immunomodulatory effects, which could enhance the host's immune response. Furthermore, the ability to recombinantly express CAM4 allows for large-scale production and facilitates further studies into its structure-function relationship, paving the way for the development of novel therapeutic agents. Understanding the mechanisms through which CAM4 operates will provide insights into its potential as a drug candidate and its applications in areas such as wound healing, infection control, and even cancer therapy. As researchers continue to explore the biochemical properties and potential applications of CAM4, it stands as a promising candidate in the search for new, effective treatment modalities against resistant infections and other related diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US