Analytical Data
-
Gene name
MPC1
- Application
-
Alternative Names
MPC1；BRP44L；Mitochondrial pyruvate carrier 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y5U8
-
Expression Region
1-109aa
-
AA Sequence
MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA
-
Molecular Weight
12.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MPC1 (Mitochondrial Pyruvate Carrier 1) is a crucial protein implicated in the transport of pyruvate into the mitochondria, where it plays a vital role in energy metabolism and cellular respiration. Given the increasing prevalence of metabolic disorders, including obesity and type 2 diabetes, understanding the function and regulation of MPC1 has garnered significant attention in recent years. Research has shown that MPC1 is pivotal for maintaining mitochondrial function and regulating metabolic pathways, as it links glycolysis in the cytosol with the tricarboxylic acid (TCA) cycle in mitochondria. Dysregulation of MPC1 is associated with various pathological conditions, including cancer, where altered metabolism is a hallmark. Consequently, scientists are investigating potential therapeutic strategies targeting MPC1 to restore normal metabolic function. Moreover, studies have highlighted the role of MPC1 in the differentiation of cells such as brown adipocytes, which are essential for thermogenesis and energy expenditure. The recombinant production of MPC1 allows for a detailed exploration of its structure and function, providing insights into its interactions with other cellular components. This research holds promise for understanding the intricate mechanisms underlying energy balance and may pave the way for innovative treatments for metabolic diseases. Overall, the study of MPC1 and its functional significance continues to be a dynamic field, bridging biochemistry, molecular biology, and clinical applications in metabolic health.
