Analytical Data
-
Gene name
msrB
- Application
-
Alternative Names
MSRB2;CBS-1;MSRB;Methionine-R-sulfoxide reductase B2. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y3D2
-
Expression Region
1-182aa
-
AA Sequence
MARLLWLLRGLTLGTAPRRAVRGQAGGGGPGTGPGLGEAGSLATCELPLAKSEWQKKLTPEQFYVTREKGTEPPFSGIYLNNKEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MSRB (methionine sulfoxide reductase B) is a crucial enzyme involved in the repair of oxidatively damaged proteins by reducing methionine sulfoxide back to methionine, thus playing a vital role in cellular defense against oxidative stress. Research on MSRB has gained prominence due to its potential implications in various biological processes, including aging, neurodegenerative diseases, and inflammation. The enzyme is known to exist in multiple isoforms, with MSRB1 and MSRB2 being the most studied, highlighting the need for comprehensive exploration of their distinct functions and regulatory mechanisms. Recombinant MSRB proteins have been developed to facilitate in-depth biochemical assays, allowing researchers to elucidate their catalytic mechanisms, substrate specificity, and interactions with other cellular components. Additionally, understanding the structure-function relationship of MSRB can provide insights into its role in redox signaling and stress response pathways. The study of MSRB also opens avenues for potential therapeutic interventions aimed at enhancing the enzyme's activity in conditions characterized by oxidative damage. Overall, research on MSRB recombinant proteins is pivotal for advancing our knowledge of oxidative stress management in cells and developing novel strategies for disease prevention and treatment.
