Analytical Data
-
Gene name
MSI2
- Application
-
Alternative Names
MSI2;RNA-binding Protein Musashi homolog 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96DH6
-
Expression Region
1-328aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMEANGSQGTSGSANDSQHDPGKMFIGG LSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDK VLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVK QYFEQFGKVEDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINN KMVECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLGMGMLGYPNFVATYG RGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNPARPGGFPGAN SPGPVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNGY H
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MSI2, or Musashi RNA-binding protein 2, is a member of the Musashi family of RNA-binding proteins that play crucial roles in the regulation of stem cell biology, cellular differentiation, and oncogenesis. It has been identified as an important player in maintaining the properties of stem cells and is often found to be dysregulated in various cancers, contributing to tumorigenesis and cancer progression. The research surrounding MSI2 largely focuses on its mechanisms of action, particularly its role in post-transcriptional regulation of target mRNAs, which can affect cell fate decisions and the proliferation of cancer cells. Studies have shown that MSI2 can interact with specific RNA sequences, modulating the stability and translation of its target mRNAs, thereby influencing critical signaling pathways involved in cell cycle regulation and apoptosis. Given its association with cancer, MSI2 has emerged as a potential biomarker for tumor progression and a target for novel therapeutic strategies. As researchers continue to elucidate the functional roles of MSI2 in different biological contexts, particularly in malignancies, understanding the molecular pathways mediated by MSI2 could pave the way for innovative approaches in cancer treatment and regenerative medicine. Therefore, the characterization of recombinant MSI2 protein becomes fundamental in studying its structure-function relationships, exploring its binding properties, and identifying potential inhibitors or modulators, all of which could significantly advance our understanding of its contribution to both normal physiology and disease states.
