Analytical Data
-
Gene name
LCE4A
- Application
-
Alternative Names
LCE4A; LEP8; SPRL4ALate cornified envelope protein 4A; Late envelope protein 8; Small proline-rich-like epidermal differentiation complex protein 4A
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TA78
-
Expression Region
1-99aa
-
AA Sequence
MSCQQNQQQCQPPPKCPIPKYPPKCPSKCASSCPPPISSCCGSSSGGCGCCSSEGGGCCLSHHRHHRSHCHRPKSSNCYGSGSGQQSGGSGCCSGGGCC
-
Molecular Weight
10.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LCE4A (Late Cornified Envelope 4A) is a member of the LCE gene family, which plays a crucial role in the process of keratinization and skin barrier function. This family is predominantly expressed in the epithelium, particularly in the skin, where it contributes to the formation of the stratum corneum, the outermost layer that protects against environmental insults. Recent studies have highlighted the involvement of LCE4A in various dermatological conditions, such as psoriasis and atopic dermatitis, suggesting its potential as a biomarker for inflammation and skin barrier dysfunction. The recombinant protein form of LCE4A serves as a valuable tool in research aimed at elucidating its functional properties. By investigating its structure and biological activities, researchers can better understand its role in skin-related diseases and explore its therapeutic potential. Additionally, the generation of LCE4A recombinant protein enables the development of assays to assess its interaction with cellular pathways, immune responses, and contribution to the skin's physiological state. Given the rising incidence of skin disorders worldwide, LCE4A and its recombinant forms present exciting prospects for advancing dermatological research and potential novel treatment strategies.
