Cat: PA2000-8866

Recombinant Human LCE5A Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LCE5A

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LCE5A; LEP18; SPRL5ALate cornified envelope protein 5A; Late envelope protein 18; Small proline-rich-like epidermal differentiation complex protein 5A

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q5TCM9

  • Expression Region

    1-118aa

  • AA Sequence

    MSCQQSQQQCQPPPKCTPKCPPKCTPKCPPKCPPKCPPQCSAPCPPPVSSCCGSSSGGCCSSEGGGCCLSHHRPRQSLRRRPQSSSCCGSGSGQQSGGSSCCHSSGGSGCCHSSGGCC

  • Molecular Weight

    39.38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LCE5A, or Late Cornified Envelope 5A, is a member of the LCE gene family, which is primarily expressed in the epidermis and plays a crucial role in skin barrier function and integrity. Research into LCE5A has gained momentum due to its potential implications in various skin disorders, such as psoriasis, eczema, and other inflammatory skin diseases. The protein is believed to participate in the cornification process, helping to regulate keratinocyte differentiation and promoting the formation of a robust stratum corneum. Moreover, studies have indicated that LCE5A may be involved in the immune response of the skin, contributing to the organ’s defense against environmental stressors and pathogens. Genetic variations and changes in the expression levels of LCE5A have been associated with altered susceptibility to skin diseases, making it an important target for understanding the molecular mechanisms behind these conditions. Consequently, exploring the recombinant expression of LCE5A protein provides opportunities for developing novel therapeutic strategies and skin-care products that could enhance skin health and treat related disorders. The research focuses not only on the functional characterization of LCE5A but also on its potential use in regenerative medicine and dermatological applications, highlighting the significance of this protein in both basic and translational research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US