Analytical Data
-
Gene name
LBX2
- Application
-
Alternative Names
LBX2; LP3727; Transcription factor LBX2; Ladybird homeobox protein homolog 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6XYB7
-
Expression Region
1-194aa
-
AA Sequence
MGKRTSLEVSLGELGGEKCRGGRRSFPPLAASRPARPGGWRWARRDLCKTASRAENNSQACRPQRRAGPDALGPGPFGRKRRKSRTAFTAQQVLELERRFVFQKYLAPSERDGLATRLGLANAQVVTWFQNRRAKLKRDVEEMRADVASLRALSPEVLCSLALPEGAPDPGLCLGPAGPDSRPHLSDEEIQVDD
-
Molecular Weight
47.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LBX2 (LIM homeobox 2) is a transcription factor that belongs to the LIM-homeodomain family, characterized by a LIM domain that is critical for protein-protein interactions. This protein is primarily involved in the development of various tissues, including the nervous system and skeletal muscle. Dysfunction or abnormal expression of LBX2 has been implicated in various diseases, including cancers and developmental disorders. Studies have shown that LBX2 plays a pivotal role in neuronal differentiation and myogenesis, influencing cellular pathways that determine cell fate. The recombinant expression of LBX2 allows researchers to produce this protein in a controlled environment, facilitating the investigation of its functional roles and mechanisms. By using techniques such as molecular cloning and protein purification, scientists can analyze LBX2's interactions with other proteins and its regulatory effects on gene expression. This research has potential therapeutic implications, particularly in regenerative medicine and cancer treatment, where modulation of LBX2 activity could offer new strategies for intervention. Understanding the structure and function of LBX2 at a molecular level not only advances our knowledge of developmental biology but also opens avenues for exploring targeted therapies in related pathologies. Overall, the study of LBX2 recombinant protein is crucial for elucidating its contributions to cellular processes and disease mechanisms.
