Analytical Data
-
Gene name
MOBKL1B
- Application
-
Alternative Names
MOB1A;C2orf6;MOB4B;MOBK1B;MOB kinase activator 1A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H8S9
-
Expression Region
1-216aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMSFLFSSRSSKTFKPKKNIPEGSHQYELLK HAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINMLYGTITEFCT EASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDET LFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLN TSFKHFIFFVQEFNLIDRRELAPLQELIEKLGSKDR
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MOBKL1B, or Mobo-like protein 1B, is part of the MOB family of proteins that play critical roles in various cellular processes, including cell cycle regulation, apoptosis, and signal transduction. The increasing interest in MOBKL1B is driven by its potential implications in cancer biology and cellular signaling pathways. Research has indicated that MOBKL1B may interact with key kinases, influencing cell proliferation and survival, making it a candidate for therapeutic interventions. Furthermore, alterations in its expression levels have been observed in several cancer types, suggesting a role in tumorigenesis and cancer progression. Studies have focused on the structural characterization and functional assays of MOBKL1B, including its binding partners and downstream effects on signaling cascades such as the Hippo pathway. Understanding the specific mechanisms by which MOBKL1B modulates these pathways could illuminate new avenues for targeted therapies and improve prognostic strategies in oncology. Continued exploration of MOBKL1B's roles in both normal and disease states remains crucial for deciphering its full biological significance and potential as a molecular target.
