Analytical Data
-
Gene name
LRRC17
- Application
-
Alternative Names
LRRC17；P37NB；Leucine-rich repeat-containing Protein 17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N6Y2
-
Expression Region
19-249aa
-
AA Sequence
RKASPGSVRSRVNHGRAGGGRRGSNPVKRYAPGLPCDVYTYLHEKYLDCQERKLVYVLPGWPQDLLHMLLARNKIRTLKNNMFSKFKKLKSLDLQQNEISKIESEAFFGLNKLTTLLLQHNQIKVLTEEVFIYTPLLSYLRLYDNPWHCTCEIETLISMLQIPRNRNLGNYAKCESPQEQKNKKLRQIKSEQLCNEEEKEQLDPKPQVSGRPPVIKPEVDSTFCHNYVFPI
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LRRC17 (Leucine-Rich Repeat Containing 17) is a protein that has garnered attention due to its potential role in various biological processes and diseases, including cancer and neurodegenerative disorders. This protein belongs to the leucine-rich repeat (LRR) family, which is characterized by the presence of multiple LRR motifs that are often involved in protein-protein interactions. Research has indicated that LRRC17 may play a critical role in cellular signaling pathways and immune responses, suggesting its importance in maintaining cellular homeostasis. Additionally, its expression patterns in different tissues and under various physiological conditions hint at its involvement in developmental processes. However, there is still a limited understanding of the functional mechanisms of LRRC17, as well as how its dysfunction might contribute to diseases. To address these gaps, studies on the recombinant form of LRRC17 have become essential for elucidating its structure-function relationships, interactions with other proteins, and potential implications in health and disease. Investigating the biochemical properties and physiological effects of recombinant LRRC17 will not only enhance our understanding of its biological significance but may also pave the way for developing therapeutic strategies targeting LRRC17-related pathways.
