Analytical Data
-
Gene name
TROSPA
- Application
-
Alternative Names
TROSPA;Tick receptor for ospA
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5SDL7
-
Expression Region
1-161aa
-
AA Sequence
MVAMEAMAAMEVMVAAMAATADTVASSAASATATEATVAMDTASLSLPLQLSPRSLPQSSLSATAATVATDTVVSSADTEVSDTEDSAATVSATASLSMLPQSSPRSLPQSSLSATAATVDSVTDMADTAMDTKQFISKGNEHFFAASYLCAWADQSAAGS
-
Molecular Weight
20.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TROSPA, an acronym for "TGF-beta receptor and OSM receptor signaling pathway-associated protein," has garnered significant attention in the field of molecular biology and therapeutic research. This recombinant protein is tied to important biological functions, particularly in regulating immune responses and inflammatory pathways. Studies have indicated that TROSPA plays a crucial role in modulating TGF-beta signaling, which is pivotal in various physiological processes, including tissue homeostasis and fibrogenesis. Dysregulation of this pathway is often linked to various diseases, such as cancer, fibrosis, and autoimmune disorders. The recombinant production of TROSPA offers a promising avenue for studying its structural and functional properties, which could lead to the development of novel therapeutic strategies. Scientists are particularly interested in understanding how TROSPA interacts with other cellular components and its potential as a biomarker for disease progression. Given its involvement in key signaling pathways, research on TROSPA could contribute to translational applications in regenerative medicine and targeted therapies, making it a focus of ongoing investigations in biochemical and pharmaceutical domains. By elucidating the mechanisms behind TROSPA function and its implications in health and disease, researchers aim to harness its potential for innovative medical interventions.











