Analytical Data
-
Gene name
MICA
- Application
-
Alternative Names
MICA;PERB11.1;MHC class I polypeptide-related sequence A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q29983
-
Expression Region
24-308aa
-
AA Sequence
EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWA EDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHE DNSTRSSQHFYYDGELFLSQNLETKEWTMPQSSRAQTLAMNVRNFLKEDA MKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITV TCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRIC QGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ
-
Molecular Weight
34 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MICA (MHC class I polypeptide-related sequence A) is a pivotal protein involved in immune system regulation, particularly in the activation of natural killer (NK) cells and other immune responses. It serves as a ligand for the NKG2D receptor on NK and some T cells, playing a crucial role in the recognition of stressed, infected, or transformed cells. Aberrant expression of MICA has been linked to various diseases, including cancer and autoimmune disorders, making it a focal point in immunotherapy and disease management studies. The research on recombinant MICA proteins has gained prominence as a means to better understand its structural and functional characteristics, which are essential for developing targeted therapies. By producing MICA in a recombinant form, scientists can achieve higher yields and purities necessary for functional assays and therapeutic applications. This approach facilitates the investigation of MICA's role in immune evasion by tumors and its potential as a biomarker for diagnosis and prognosis. Furthermore, recombinant MICA proteins are valuable for studying their interactions with NKG2D and other receptors, aiding in the design of innovative immunotherapeutic strategies that boost anti-tumor immunity. Overall, the exploration of recombinant MICA proteins not only deepens our understanding of immune mechanisms but also opens new avenues for clinical applications aimed at enhancing immune responses against malignancies and infections.
