Analytical Data
-
Gene name
KRTAP5-7
- Application
-
Alternative Names
KRTAP5-7; KAP5-7; KAP5.3; KRTAP5.3; KRTAP5.7Keratin-associated protein 5-7; Keratin-associated protein 5-3; Keratin-associated protein 5.3; Keratin-associated protein 5.7; Ultrahigh sulfur keratin-associated protein 5.7
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6L8G8
-
Expression Region
1-165aa
-
AA Sequence
MGCCGCSEGCGSGCGGCGSGCGGCGSGCGGCGSSCCVPVCCCKPVCCCVPACSCSSCGSCGGSKGGCGSCGGSKGGCGSCGGSKGGCGSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCCQSSCCKPCCCSSGCGSSCCQSSCCNPCCSQSSCCVPVCCQCKI
-
Molecular Weight
45.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRTAP5-7, a member of the keratin-associated protein (KRTAP) family, plays a critical role in the structure and function of hair, skin, and nails in mammals. It is primarily involved in the formation of the inner root sheath of hair follicles, contributing to the mechanical properties and resilience of keratinous structures. Research on KRTAP5-7 is particularly significant due to its potential implications in hair growth disorders, skin diseases, and conditions affecting keratin production. Additionally, KRTAPs are known for their involvement in the formation of the cornified cell envelope, which is essential for skin barrier function. Studies have shown that mutations or dysregulation of KRTAPs may lead to various dermatological conditions, making them a target for therapeutic interventions. The recombinant production of KRTAP5-7 enables researchers to investigate its structure-function relationships, interactions with other keratins and proteins, and potential applications in regenerative medicine. Understanding the properties and mechanisms of KRTAP5-7 could provide insights into hair and skin biology, paving the way for novel treatments for hair loss and skin disorders.
