Analytical Data
-
Gene name
KRTAP5-8
- Application
-
Alternative Names
KRTAP5-8; KAP5.8; KRTAP5.8; UHSKB; Keratin-associated protein 5-8; Keratin; ultra high-sulfur matrix protein B; Keratin-associated protein 5.8; UHS keratin B; UHS KerB; Ultrahigh sulfur keratin-associated protein 5.8
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O75690
-
Expression Region
1-187aa
-
AA Sequence
MGCCGCSGGCGSGCGGCGSGCGGCGSSCCVPICCCKPVCCCVPACSCSSCGSCGGSKGGRGSCGGSKGDCGSCGGSKGGCGSCGCSQCSCYKPCCCSSGCGSSCCQSSCCKPCCSQSSCCKPCSCSSGCGSSCCQSSCCKPCCSQSSCCKPCCCSSGCGSSCCQSSCCKPCCSQSSCCVPICCQCKI
-
Molecular Weight
20.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRTAP5-8, a member of the keratin-associated protein (KRTAP) family, plays a significant role in the structural integrity and functionality of hair and skin. These proteins are crucial for the formation of the outermost protective layer of the epidermis, contributing to the mechanical properties and resilience of hair fibers. Studies have highlighted the importance of KRTAP5-8 in the context of various hair types and conditions, suggesting its involvement in hair texture, thickness, and even certain forms of hair disorders. Recent advancements in molecular biology techniques have enabled researchers to explore the expression patterns and regulatory mechanisms of KRTAP5-8, leading to insights into its functional significance in hair follicle biology. Additionally, the recombinant protein of KRTAP5-8 has been utilized in experimental studies to better understand its biochemical properties and interactions with other keratins and structural proteins. This research not only enhances our knowledge of hair morphology but also opens potential avenues for therapeutic applications in treating hair-related conditions, as well as providing insights into the evolutionary adaptations of hair characteristics among different species. Overall, the investigation of KRTAP5-8 recombinant protein highlights its critical role in dermatological sciences and its potential implications in cosmetic and medical fields.
