Cat: PA2000-8811

Recombinant Human KRTAP4-4 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KRTAP4-4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KRTAP4-4; KAP4.13; KAP4.4; KRTAP4-13; KRTAP4.13; KRTAP4.4Keratin-associated protein 4-4; Keratin-associated protein 4-13; Keratin-associated protein 4.13

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BYR3

  • Expression Region

    1-166aa

  • AA Sequence

    MVNSCCGSVCSDQGCGLENCCRPSYCQTTCCRTTCCRPSCCVSSCCRPQCCQTTCCRTTCCHPSCCVSSCCRPQCCQSVCCQPTCCRPQCCQTTCCRTTCCRPSCCRPQCCQSVCCQPTCCCPSYCVSSCCRPQCCQTTCCRTTCCRPSCCVSRCYRPHCGQSLCC

  • Molecular Weight

    44.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KRTAP4-4 (Keratin Associated Protein 4-4) is a member of the keratin-associated protein (KAP) family, which plays a crucial role in the structure and function of the hair, skin, and nails by influencing the properties of keratin fibers. Recent studies have highlighted the significance of KRTAP4-4 in the formation of the hair shaft, contributing to its mechanical strength and resilience. Mutations or alterations in KRTAP4-4 gene expression can lead to various hair disorders, making it an important target for research in dermatology and genetics. Additionally, KRTAP4-4 serves as a valuable model for studying the molecular mechanisms of keratinization and the interplay between different keratin-associated proteins in epithelial tissues. Understanding the structure and function of recombinant KRTAP4-4 protein could facilitate advancements in regenerative medicine, cosmetic science, and the development of therapeutic strategies for hair and skin disorders. Researchers aim to elucidate its properties, interactions, and potential applications, paving the way for novel treatments and improving the understanding of keratin biology at both the basic and clinical levels.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US