Analytical Data
-
Gene name
DAZL
- Application
-
Alternative Names
DAZL;DAZH;DAZL1;DAZLA;Deleted in azoospermia-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q92904
-
Expression Region
130-250aa
-
AA Sequence
VFNHPPPPQFQNVWTNPNTETYMQPTTTMNPITQYVQAYPTYPNSPVQVITGYQLPVYNYQMPPQWPVGEQRSYVVPPAYSAVNYHCNEVDPGAEVVPNECSVHEATPPSGNGPQKKSVDR
-
Molecular Weight
50.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
DAZL (Deleted in Azoospermia-Like) is a critical RNA-binding protein involved in the regulation of gametogenesis, particularly in males. It is a member of the DAZ gene family, which plays a fundamental role in the post-transcriptional control of gene expression during embryonic development and germ cell maturation. Research has shown that DAZL is essential for spermatogenesis, as it influences the stability and translation of mRNAs that are important for sperm development. Mutations or deletions in the DAZL gene have been associated with infertility conditions, particularly azoospermia in males, highlighting its significance in reproductive biology. The understanding of DAZL function and its molecular mechanisms has important implications for developmental biology, fertility treatments, and potential therapeutic interventions for male infertility. Recent studies aim to elucidate the structural characteristics of DAZL and how its reorganization and interactions with RNA impact the gene regulatory networks involved in sperm production. As researchers delve deeper into the functional aspects of DAZL, they hope to uncover new insights that could lead to innovative reproductive technologies and enhance our understanding of male fertility disorders.











