Analytical Data
-
Gene name
KRTAP1-5
- Application
-
Alternative Names
KRTAP1-5; KAP1.5; KRTAP1.5Keratin-associated protein 1-5; High sulfur keratin-associated protein 1.5; Keratin-associated protein 1.5
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BYS1
-
Expression Region
1-174aa
-
AA Sequence
MTCCQTSFCGYPSFSISGTCGSSCCQPSCCETSCCQPRSCQTSFCGFPSFSTSGTCSSSCCQPSCCETSCCQPSCCETSCCQPSCCQISSCGTGCGIGGGISYGQEGSSGAVSTRIRWCRPDSRVEGTYLPPCCVVSCTPPSCCQLHHAQASCCRPSYCGQSCCRPVCCCEPTC
-
Molecular Weight
44.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRTAP1-5, a member of the keratin-associated proteins (KRTAPs) family, has garnered attention in the field of molecular biology and dermatology due to its significant role in hair structure and function. Keratin-associated proteins are crucial for the formation of the hair follicle and the overall integrity of the keratinized tissues, which include hair, skin, and nails. KRTAP1-5, specifically, is known to contribute to the physical properties of hair fibers, such as tensile strength and resilience. The study of KRTAP1-5 involves exploring its expression patterns, genetic regulation, and contributions to hair disorders and alopecia. Research has demonstrated that variations in KRTAP genes can influence hair morphology and texture, making them important targets for understanding hair growth mechanisms and developing potential therapeutic interventions for hair loss conditions. Furthermore, the recombinant expression of KRTAP1-5 facilitates the investigation of its functional properties in vitro, providing insights into its interactions with keratins and other cellular components. Understanding the molecular basis of KRTAP1-5 function and regulation not only elucidates fundamental biological processes but also holds promise for applications in cosmetic and regenerative dermatology.
