Analytical Data
-
Gene name
KRTAP13-1
- Application
-
Alternative Names
KRTAP13-1; KAP13.1; KRTAP13.1Keratin-associated protein 13-1; High sulfur keratin-associated protein 13.1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8IUC0
-
Expression Region
1-193aa
-
AA Sequence
MWHANSESSQCNSAELTSPINMSYNCCSGNFSSRSCGGYLHYPASSCGFSYPSNQVYSTDLCSPSTCQLGSSLYRGCQQTCWEPTSCQTSYVESSPCQTSCYRPRTSLLCSPCQTTYSGSLGFGSSSCRSLGYGSRSCYSVGCGSSGFRSLGYGGCGFPSLGYGVGFCRPTYLASRSCQSSCYRPTCGSGFYY
-
Molecular Weight
47 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRTAP13-1, or Keratin Associated Protein 13-1, is a member of the keratin-associated protein family, which plays a critical role in the structural integrity and biomechanical properties of the hair and epidermis. This protein is primarily expressed in the outer root sheath of hair follicles and contributes to the formation of keratin intermediate filaments, essential for hair strength and resilience. Research into KRTAP13-1 is significant due to its implications in hair follicle biology, particularly in relation to hair disorders and abnormalities. Mutations or dysregulation of this gene can lead to hair disorders, such as hypotrichosis and alopecia, highlighting its potential as a target for therapeutic interventions. Furthermore, KRTAP13-1 may hold promise for biotechnological applications in hair and skin tissue engineering. Advances in recombinant protein technology have facilitated the production of KRTAP13-1 in various systems, enabling in-depth studies of its structure, function, and interaction with keratins. Understanding KRTAP13-1's role can provide insights into the molecular mechanisms of hair follicle development and the pathology of hair loss conditions, potentially leading to novel treatments. Thus, the study of KRTAP13-1 not only enhances our fundamental knowledge of keratin biology but also opens avenues for clinical and therapeutic advancements in treating keratin-associated disorders.
