Cat: PA2000-8796

Recombinant Human KRTAP10-2 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KRTAP10-2

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KRTAP10-2; KAP10.2; KAP18-2; KRTAP10.2; KRTAP18-2; KRTAP18.2; Keratin-associated protein 10-2; High sulfur keratin-associated protein 10.2; Keratin-associated protein 10.2; Keratin-associated protein 18-2; Keratin-associated protein 18.2

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P60368

  • Expression Region

    1-255aa

  • AA Sequence

    MAASTMSICSSACTNSWQVDDCPESCCELPCGTPSCCAPAPCLTLVCTPVSCVSSPCCQAACEPSACQSGCTSSCTPSCCQQSSCQPACCTSSPCQQACCVPVCCKPVCCVPVCCGASSCCQQSSCQPACCASSSCQQSCRVPVCCKAVCCVPTCSESSSSCCQQSSCQPACCTSSPCQQSCCVSVCCKPVCCKSICCVPVCSGASSPCCQQSSCQPACCTSSCCRPSSSVSLLCRPVCSRPASCSFSSGQKSSC

  • Molecular Weight

    55 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KRTAP10-2, also known as keratin-associated protein 10-2, is part of the keratin-associated protein (KRTAP) family, which plays crucial roles in the structural integrity and functionality of hair and other keratin-containing tissues. Research into KRTAP10-2 has gained prominence due to its potential involvement in various hair disorders and its relevance in understanding hair follicle biology. This protein contributes to the unique properties of intermediate filaments in hair, influencing characteristics such as tensile strength and elasticity. Mutations or dysregulation of KRTAP genes, including KRTAP10-2, have been implicated in conditions like monilethrix and hypotrichosis, leading scientists to investigate its molecular mechanisms further. Understanding KRTAP10-2 at a molecular level could provide insights into the genetic basis of these disorders and may have implications for the development of therapeutic strategies aimed at restoring normal hair growth and health. Moreover, the recombinant production of KRTAP10-2 allows for in-depth functional studies and potential applications in biomaterials and regenerative medicine, highlighting its significance in both basic and applied research.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US