Analytical Data
-
Gene name
MED27
- Application
-
Alternative Names
MED27;CRSP34;CRSP8;Mediator of RNA polymerase II transcription subunit 27
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6P2C8
-
Expression Region
1-311aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMADVINVSVNLEAFSQAISAIQALRSS VSRVFDCLKDGMRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLV GKPSENHPLHNSGLLSLDPVQDKTPLYSQLLQAYKWSNKLQYHAGLASGL LNQQSLKRSANQMGVSAKRRPKAQPTTLVLPPQYVDDVISRIDRMFPEMS IHLSRPNGTSAMLLVTLGKVLKVIVVMRSLFIDRTIVKGYNENVYTEDGK LDIWSKSNYQVFQKVTDHATTALLHYQLPQMPDVVVRSFMTWLRSYIKLF QAPCQRCGKFLQDGLPPTWRDFRTLEAFHDTCRQ
-
Molecular Weight
38 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MED27 is a critical subunit of the Mediator complex, which serves as a key regulatory hub that links transcriptional activators and repressors to the RNA polymerase II machinery. This complex is essential for the regulation of gene expression and plays a pivotal role in various biological processes, including cell differentiation, proliferation, and response to environmental stimuli. Given its importance in gene regulation, abnormalities in MED27 can lead to various diseases, including cancer. Research focusing on the structural and functional aspects of MED27 has gained momentum, particularly its interactions with other proteins and its role in mediating transcriptional responses under different cellular conditions. Recent studies utilizing techniques such as cryo-electron microscopy and x-ray crystallography have provided deeper insights into its structural conformation and dynamic behavior within the Mediator complex. Moreover, there is growing interest in developing MED27-targeted therapeutics that could potentially modulate its function in disease contexts, making it a valuable target for novel treatment strategies. Understanding the multifaceted roles of MED27 not only enhances the fundamental knowledge of transcriptional regulation but also opens new avenues for therapeutic interventions in various pathologies.
