Analytical Data
-
Gene name
MED4
- Application
-
Alternative Names
MED4;ARC36;DRIP36;VDRIP;Mediator of RNA polymerase II transcription subunit 4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NPJ6
-
Expression Region
1-270aa
-
AA Sequence
MAASSSGEKEKERLGGGLGVAGGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMSMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MED4, a crucial component of the Mediator complex, plays a significant role in transcription regulation in eukaryotic cells. The Mediator serves as a bridge between gene-specific transcription factors and the RNA polymerase II machinery, facilitating the transcription of mRNA from DNA. The study of MED4 has garnered increasing attention due to its implications in various biological processes, including cell growth, differentiation, and response to environmental signals. Dysregulation of MED4 and other Mediator components has been linked to several diseases, including cancers and metabolic disorders, highlighting the necessity for detailed understanding of its structure and function. Researchers aim to explore the biochemical properties, interactions, and cellular mechanisms involving MED4 through recombinant protein techniques, which allow for the production of pure MED4 in controlled laboratory conditions. This approach enables detailed functional assays, structural studies, and interactions with other proteins or nucleic acids, contributing to our understanding of the fundamental mechanisms of gene regulation. By elucidating the role of MED4 within the Mediator complex and its regulatory pathways, scientists hope to uncover novel therapeutic targets and strategies for diseases associated with transcriptional dysregulation. Thus, MED4 recombinant protein studies are essential for advancing our comprehension of gene expression control and its implications in health and disease.
