Analytical Data
-
Gene name
KRT82
- Application
-
Alternative Names
KRT82; KRTHB2; Keratin; type II cuticular Hb2; Keratin-82; K82; Type II hair keratin Hb2; Type-II keratin Kb22
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NSB4
-
Expression Region
1-513aa
-
AA Sequence
MSYHSFQPGSRCGSQSFSSYSAVMPRMVTHYAVSKGPCRPGGGRGLRALGCLGSRSLCNVGFGRPRVASRCGGTLPGFGYRLGATCGPSACITPVTINESLLVPLALEIDPTVQRVKRDEKEQIKCLNNRFASFINKVRFLEQKNKLLETKWNFMQQQRCCQTNIEPIFEGYISALRRQLDCVSGDRVRLESELCSLQAALEGYKKKYEEELSLRPCVENEFVALKKDVDTAFLMKADLETNAEALVQEIDFLKSLYEEEICLLQSQISETSVIVKMDNSRELDVDGIIAEIKAQYDDIASRSKAEAEAWYQCRYEELRVTAGNHCDNLRNRKNEILEMNKLIQRLQQETENVKAQRCKLEGAIAEAEQQGEAALNDAKCKLAGLEEALQKAKQDMACLLKEYQEVMNSKLGLDIEIATYRRLLEGEEHRLCEGIGPVNISVSSSKGAFLYEPCGVSTPVLSTGVLRSNGGCSIVGTGELYVPCEPQGLLSCGSGRKSSMTLGAGGSSPSHKH
-
Molecular Weight
82.83 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRT82, also known as keratin 82, is part of the keratin family, which consists of fibrous proteins that play a crucial role in the structure and resilience of epithelial cells. The study of KRT82 has gained attention due to its potential implications in various biological processes, including epithelial integrity, wound healing, and cellular differentiation. Keratins are essential components of the cytoskeleton and are involved in maintaining the mechanical properties of cells, particularly in tissues that are subjected to stress. Research indicates that alterations in keratin expression can be associated with several pathological conditions, including skin disorders and cancers. Specifically, KRT82 may be involved in regulating cellular responses to stress and inflammation, highlighting its significance in both normal physiology and disease states. Furthermore, the production of recombinant KRT82 protein offers valuable opportunities for investigating its functional roles in vitro and in vivo, facilitating a deeper understanding of its mechanisms and potential therapeutic applications. As researchers continue to explore the multifaceted roles of keratins, KRT82 stands out as a candidate for further study, with the potential to uncover new insights into epithelial biology and its associated disorders.
