Analytical Data
-
Gene name
KRT78
- Application
-
Alternative Names
CK-78; Cytokeratin-78; K2C78_HUMAN; K5B; K78; Kb40; Keratin; Keratin. type II cytoskeletal 78; Keratin-5b; Keratin-78; KRT78; type II cytoskeletal 78; Type-II keratin Kb40
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N1N4
-
Expression Region
1-520aa
-
AA Sequence
MSLSPCRAQRGFSARSACSARSRGRSRGGFSSRGGFSSRSLNSFGGCLEGSRGSTWGSGGRLGVRFGEWSGGPGLSLCPPGGIQEVTINQNLLTPLKIEIDPQFQVVRTQETQEIRTLNNQFASFIDKVRFLEQQNKVLETKWHLLQQQGLSGSQQGLEPVFEACLDQLRKQLEQLQGERGALDAELKACRDQEEEYKSKYEEEAHRRATLENDFVVLKKDVDGVFLSKMELEGKLEALREYLYFLKHLNEEELGQLQTQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEAEALYQTKYQELQVSAQLHGDRMQETKVQISQLHQEIQRLQSQTENLKKQNASLQAAITDAEQRGELALKDAQAKVDELEAALRMAKQNLARLLCEYQELTSTKLSLDVEIATYRRLLEGEECRMSGECTSQVTISSVGGSAVMSGGVGGGLGSTCGLGSGKGSPGSCCTSIVTGGSNIILGSGKDPVLDSCSVSGSSAGSSCHTILKKTVESSLKTSITY
-
Molecular Weight
83.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KRT78, also known as keratin 78, is a member of the keratin family of proteins that play crucial roles in the structure and function of epithelial tissues. As an intermediate filament protein, KRT78 contributes to the mechanical stability and integrity of cells, particularly in the skin and other stratified epithelial tissues. The study of KRT78 is significant due to its potential involvement in various pathological conditions, including skin disorders and cancers. Recent research has focused on the expression patterns of KRT78 in different cell types and its regulatory mechanisms, providing insights into its functional roles in both normal physiology and disease states. Recombinant KRT78 protein has emerged as a valuable tool for investigating its molecular interactions and mechanistic pathways. By producing KRT78 in a recombinant system, researchers can study its properties in isolation, enabling the exploration of its role in cellular processes such as differentiation, apoptosis, and response to stress. This recombinant approach also facilitates the development of targeted therapies and biomaterials, leveraging the unique properties of keratin proteins. Overall, the research on KRT78 and its recombinant form is pivotal for advancing our understanding of keratin biology and its implications in health and disease.











