Cat: PA1000-1931

Recombinant Human MECR Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MECR

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MECR;NBRF1;Enoyl-[acyl-carrier-Protein] reductase. mitochondrial

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9BV79

  • Expression Region

    54-373aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMPAKVVELKNLELAAVRGSDVRVKMLAAPI NPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSNVTGLKPGDWVIPAN AGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQ PGDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLG AEHVITEEELRRPEMKNFFKDMPQPRLALNCVGGKSSTELLRQLARGGTM VTYGGMAKQPVVASVSLLIFKDLKLRGFWLSQWKKDHSPDQFKELILTLC DLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTM

  • Molecular Weight

    37 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MECR (Mitochondrial Elongation of Very Long Chain fatty acids Reductase) is an essential enzyme located in the mitochondria, playing a pivotal role in fatty acid metabolism, particularly in the elongation of very long-chain fatty acids (VLCFAs). VLCFAs are crucial for the formation of bioactive lipids, which are involved in various cellular processes, including membrane structure, energy storage, and signaling pathways. Aberrant MECR activity has been linked to several metabolic disorders, emphasizing its importance in human health. The study of MECR recombinant proteins helps elucidate the enzyme's structural and functional characteristics. Through the recombinant expression of MECR, researchers are able to investigate its enzymatic properties, substrate specificity, and interaction with other mitochondrial components. Understanding MECR's role at a molecular level may reveal new therapeutic targets for diseases associated with lipid metabolism, such as neurological disorders, heart diseases, and certain types of cancer, where lipid dysregulation plays a significant role. Consequently, the production and characterization of MECR recombinant proteins are critical for advancing both fundamental and applied research in lipid biochemistry and metabolic health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US