Cat: PA1000-1929

Recombinant Human MDP1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MDP1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    DPEP1;MDP;RDP;Dipeptidase 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q86V88

  • Expression Region

    1-176aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSHMARLPKLAVFDLDYTLWPFWVDTHVD PPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEG ANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERR NIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA

  • Molecular Weight

    23 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MDP1 (Myelin Differentiation Protein 1) is a crucial protein involved in the formation and maintenance of myelin, the protective sheath surrounding nerve fibers, which is essential for proper neuronal function and signal transmission. Abnormalities in myelination processes are associated with various neurological disorders, including multiple sclerosis and leukodystrophies. The study of MDP1 and its recombinant proteins has gained significant interest in recent years due to its potential therapeutic implications. Researchers aim to understand the structure-function relationship of MDP1, its role in oligodendrocyte development, and the signaling pathways it influences. Additionally, recombinant MDP1 can be utilized in experimental models to investigate myelination and demyelination mechanisms, providing insights into potential regenerative therapies for nervous system injuries. Current studies are focusing on optimizing the production and characterization of MDP1 recombinant proteins to facilitate their use in both basic research and clinical applications. By elucidating the biochemical properties and interactions of MDP1, scientists hope to identify novel targets for therapeutic intervention in demyelinating diseases, ultimately leading to the development of effective treatments that can enhance myelin repair and improve neurological outcomes.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US