Cat: PA2000-4668

Recombinant Human SCGB2A1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    SCGB2A1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SCGB2A1;LIPHC;MGB2;UGB3;Mammaglobin-B

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O75556

  • Expression Region

    19-95aa

  • AA Sequence

    DSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN

  • Molecular Weight

    14.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

SCGB2A1, also known as Secretoglobin family 2A member 1, is a protein encoded by the SCGB2A1 gene that plays a crucial role in various physiological processes, including immune response, inflammation, and respiratory function. Studies have indicated that SCGB2A1 is predominantly expressed in the epithelial cells of the airways and is involved in the secretion of mucus and modulation of airway inflammation. Its dysregulation has been implicated in several respiratory diseases, such as asthma and chronic obstructive pulmonary disease (COPD). Given its significance in lung health, researchers have focused on the potential therapeutic applications of SCGB2A1, aiming to understand its structural characteristics and functional mechanisms through recombinant protein studies. The production of recombinant SCGB2A1 allows for detailed investigations into its interaction with other biomolecules and its role in disease pathology. Furthermore, it provides a platform for exploring its potential use as a biomarker or therapeutic target in respiratory diseases, thus holding promise for advancing treatments that could alleviate the burden of these conditions. As a result, ongoing research into SCGB2A1 recombinant protein is vital for uncovering new insights into its biological functions and therapeutic potential in respiratory health.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US