Analytical Data
-
Gene name
MAPK14
- Application
-
Alternative Names
MAPKAPK2;MAP kinase-activated Protein kinase 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q16539
-
Expression Region
2-360aa
-
AA Sequence
SQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
-
Molecular Weight
72.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAPK14, also known as p38 MAPK, is a crucial member of the mitogen-activated protein kinase (MAPK) family, which plays a significant role in cellular responses to various stress stimuli, inflammatory processes, and apoptotic signals. This protein is primarily involved in regulating gene expression, cell proliferation, differentiation, and survival, making it a focal point of research in cancer, neurodegenerative diseases, and inflammatory conditions. MAPK14 is activated by various stressors such as heat shock, oxidative stress, and cytokines, triggering a cascade of signaling pathways that ultimately influence cell fate. The study of recombinant MAPK14 protein offers insights into its structural and functional properties, facilitating the understanding of its mechanisms in health and disease. By producing this protein in vitro, researchers can investigate its enzymatic activity, interaction with other proteins, and potential therapeutic targets. Furthermore, recombinant MAPK14 can be utilized in high-throughput screening assays to identify small molecules that modulate its activity, paving the way for novel drugs aimed at treating associated disorders. The exploration of MAPK14 thus holds promise for advancing therapeutic strategies against a range of pathologies characterized by dysregulated signaling pathways.
