Analytical Data
-
Gene name
KLK3
- Application
-
Alternative Names
Fletcher factor; kallikrein B plasma; Kallikrein B plasma (Fletcher factor) 1; Kallikrein B; plasma 1; Kallikrein B1; Kininogenin; KLK3; KLKB1; KLKB1_HUMAN; PKK; PKKD; Plasma kallikrein; Plasma kallikrein B1; Plasma kallikrein light chain; Plasma prekallikrein; PPK; Prekallikrein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P03952
-
Expression Region
20-390aa
-
AA Sequence
GCLTQLYENAFFRGGDVASMYTPNAQYCQMRCTFHPRCLLFSFLPASSINDMEKRFGCFLKDSVTGTLPKVHRTGAVSGHSLKQCGHQISACHRDIYKGVDMRGVNFNVSKVSSVEECQKRCTNNIRCQFFSYATQTFHKAEYRNNCLLKYSPGGTPTAIKVLSNVESGFSLKPCALSEIGCHMNIFQHLAFSDVDVARVLTPDAFVCRTICTYHPNCLFFTFYTNVWKIESQRNVCLLKTSESGTPSSSTPQENTISGYSLLTCKRTLPEPCHSKIYPGVDFGGEELNVTFVKGVNVCQETCTKMIRCQFFTYSLLPEDCKEEKCKCFLRLSMDGSPTRIAYGTQGSSGYSLRLCNTGDNSVCTTKTSTR
-
Molecular Weight
43.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLK3, also known as prostate-specific antigen (PSA), is a serine protease encoded by the KLK3 gene and primarily produced in the prostate gland. It has gained significant attention in biomedical research due to its pivotal role in prostate cancer diagnosis and management. Elevated levels of KLK3 in serum are commonly associated with prostate cancer, making it a key biomarker for disease detection and monitoring treatment responses. The study of recombinant KLK3 proteins has provided insights into its functional properties, including enzymatic activity and regulatory mechanisms, which are crucial for understanding its role in tumor progression and metastasis. Furthermore, understanding the structural and functional dynamics of KLK3 has implications for therapeutic interventions, as it may serve as a target for novel treatments aimed at prostate cancer. Advances in recombinant protein technology have enabled the production of KLK3 for various applications, including the development of more sensitive assays for early detection of prostate malignancies and potential therapeutic agents. Ongoing research into KLK3 not only enhances our understanding of prostate cancer biology but also facilitates improvements in diagnostic tools and treatment strategies, making it a focal point in the field of oncology.
