Analytical Data
-
Gene name
IkBd
- Application
-
Alternative Names
IkBd;IKBNS;NF-kappa-B inhibitor delta
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NI38
-
Expression Region
1-313aa
-
AA Sequence
MEAGPWRVSAPPSGPPQFPAVVPGPSLEVARAHMLALGPQQLLAQDEEGDTLLHLFAARGLRWAAYAAAEVLQVYRRLDIREHKGKTPLLVAAAANQPLIVEDLLNLGAEPNAADHQGRSVLHVAATYGLPGVLLAVLNSGVQVDLEARDFEGLTPLHTAILALNVAMRPSDLCPRVLSTQARDRLDCVHMLLQMGANHTSQEIKSNKTVLHLAVQAANPTLVQLLLELPRGDLRTFVNMKAHGNTALHMAAALPPGPAQEAIVRHLLAAGADPTLRNLENEQPVHLLRPGPGPEGLRQLLKRSRVAPPGLSS
-
Molecular Weight
33.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
The research on IkBd recombinant protein stems from its critical role in the regulation of the NF-kB signaling pathway, a crucial mechanism that controls the expression of genes involved in immune response, inflammation, and cell survival. NF-kB is typically kept in the cytoplasm in an inactive form bound to IkB proteins. Upon stimulation by various extracellular signals, IkB is phosphorylated, leading to its degradation and the subsequent release and translocation of NF-kB into the nucleus to activate target genes. Understanding the structure and function of IkBd (the inhibitor of kappa B delta) becomes vital as it plays a significant part in modulating the activity of NF-kB, influencing numerous pathological conditions, including cancer, autoimmune diseases, and infectious diseases. The recombinant expression of IkBd allows for detailed biochemical studies and functional assays, enabling researchers to elucidate its interactions with NF-kB and other signaling molecules. This knowledge is essential not only to develop potential therapeutic strategies targeted at modulating this pathway but also to explore the broader implications of IkBd in cellular processes. As a result, IkBd recombinant proteins have become a focal point in both basic research and pharmaceutical development, illustrating their importance in advancing our understanding of cell signaling and therapeutic innovations.











