Analytical Data
-
Gene name
MAP1LC3B2
- Application
-
Alternative Names
MAP1LC3B2;Microtubule-associated Proteins 1A/1B light chain 3 beta 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A6NCE7
-
Expression Region
1-120aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMPSEKTFKQRRTFEQRVEDVRLIREQHPTK IPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFF LLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFG
-
Molecular Weight
16 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MAP1LC3B2, a member of the microtubule-associated protein 1 light chain 3 (LC3) family, plays a crucial role in autophagy, a cellular process essential for maintaining homeostasis and responding to stress. Autophagy is implicated in various physiological and pathological processes, including neurodegeneration, cancer, and infectious diseases. MAP1LC3B2 is essential for the formation of autophagosomes and is involved in the targeting of cellular components for degradation. Unlike its isoform MAP1LC3B, which has been widely studied, the specific functions and regulatory mechanisms of MAP1LC3B2 remain less understood. Research has shown that MAP1LC3B2 can contribute to selective autophagy pathways, influencing cellular responses to stress and mediating the clearance of damaged organelles. Investigating this protein could enhance our understanding of autophagy's role in disease progression and its potential as a therapeutic target. Given its unique properties and functions, MAP1LC3B2 presents an interesting subject for further study, with the potential to reveal novel insights into autophagy regulation and its implications in health and disease.
