Analytical Data
-
Gene name
KLHL29
- Application
-
Alternative Names
KBTBD9; Kelch like protein 29; kelch repeat and BTB (POZ) domain containing 9; Kelch repeat and BTB domain containing protein 9 ; Kelch repeat and BTB domain-containing protein 9; Kelch-like protein 29; KIAA1921; KLH29_HUMAN; KLHL 29; Klhl29
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96CT2
-
Expression Region
1-503aa
-
AA Sequence
MPGHYSLPQPPSQPLSSVVVNMPAQALYASPQPLAVSTLPGVGQVARPGPTAVGNGHMAGPLLPPPPPAQPSATLPSGAPATNGPPTTDSAHGLQMLRTIGVGKYEFTDPGHPREMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASCSLYFKDLIQRSVQDSGQGGREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDFIAYVSNDSLNTKAEELVYETVIKWIKKDPATRTQYAAELLAVVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQRSLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVER
-
Molecular Weight
81.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KLHL29 is a member of the Kelch-like protein family, characterized by the presence of a BTB (Broad-Complex, Tramtrack, and Bric-a-Brac) domain and multiple Kelch repeats. This protein has garnered attention in recent years due to its potential roles in various cellular processes, including protein degradation, cell signaling, and cytoskeletal organization. Its involvement in diseases, particularly in the context of neurodegenerative disorders and cancer, has further intensified research efforts. Studies have indicated that KLHL29 may act as an E3 ubiquitin ligase, facilitating the ubiquitination and subsequent proteasomal degradation of target proteins, thereby influencing cellular homeostasis. Moreover, aberrations in KLHL29 expression levels have been associated with pathological conditions, underscoring its importance in maintaining cellular functions. The recombinant production of KLHL29 protein is critical for in-depth biochemical and biophysical analyses, enabling researchers to decode its mechanism of action, identify substrate proteins, and explore its therapeutic potential. Understanding the functional implications of KLHL29 at a molecular level could yield insights into its role in health and disease, paving the way for novel intervention strategies. Consequently, extensive studies focusing on the structural properties, interaction networks, and regulatory mechanisms of KLHL29 are essential to elucidate its full biological significance and therapeutic applications.
