Analytical Data
-
Gene name
GPR132
- Application
-
Alternative Names
GPR132；G2A；Probable G-Protein coupled receptor 132
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UNW8
-
Expression Region
311-380aa
-
AA Sequence
ATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEESC
-
Molecular Weight
39.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
GPR132, also known as G protein-coupled receptor 132 or GPR132, is a member of the G protein-coupled receptor (GPCR) superfamily, which plays a crucial role in various physiological processes, including immune response, cell proliferation, and metabolism. Research has indicated that GPR132 is involved in the regulation of several signaling pathways, notably those associated with inflammation and lymphocyte activation. Its expression is prominent in immune cells, such as macrophages and T cells, suggesting its potential role in modulating immune responses and contributing to various diseases, including cancer and autoimmune disorders. Additionally, studies have linked GPR132 to metabolic regulation, indicating its relevance in conditions like obesity and diabetes. Given its multifaceted roles, the recombinant production of GPR132 protein allows for in-depth characterization of its structure and function, facilitating the discovery of its ligands and downstream signaling mechanisms. Understanding GPR132’s role through recombinant protein studies could pave the way for novel therapeutic strategies targeting immune and metabolic diseases, emphasizing the importance of this receptor in health and disease.
