Analytical Data
-
Gene name
SYK
- Application
-
Alternative Names
SYK;Tyrosine-Protein kinase SYK
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43405
-
Expression Region
359-635aa
-
AA Sequence
RPKEVYLDRKLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEA NDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNK YLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYA KISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSF GVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLC WTYDVENRPGFAAVELRLRNYYYDVVN
-
Molecular Weight
58 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Syk (spleen tyrosine kinase) is a cytoplasmic protein tyrosine kinase that plays a crucial role in various signaling pathways, particularly in immune cell activation, B cell receptor signaling, and inflammation. Research on Syk has gained momentum due to its pivotal role in immune responses and its potential as a therapeutic target for autoimmune diseases, cancer, and hematological disorders. The interest in recombinant Syk protein has arisen from the need to better understand its structure-function relationships and the molecular mechanisms underlying its activation and regulation. Scientists have been using various expression systems to produce Syk protein in sufficient quantities for structural biology studies and functional assays. The recombinant Syk protein can help elucidate its interactions with other signaling molecules, receptors, and substrates, thereby advancing our knowledge of Syk's role in health and disease. Moreover, understanding Syk's dynamics may pave the way for the development of selective Syk inhibitors, which could lead to new treatment strategies for conditions characterized by dysregulated immune responses and excessive cell proliferation. Overall, the exploration of Syk recombinant protein holds promise for both basic research and therapeutic innovation, highlighting its significance in the fields of immunology and drug development.











