Cat: PA1000-1836

Recombinant Human LRP2BP Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LRP2BP

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LRP2BP;KIAA1325;LRP2-binding Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9P2M1

  • Expression Region

    1-347aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMGSMKLTSEKLPKNPFYASVSQYAAKNQKF FQWKKEKTDYTHANLVDKALQLLKERILKGDTLAYFLRGQLYFEEGWYEE ALEQFEEIKEKDHQATYQLGVMYYDGLGTTLDAEKGVDYMKKILDSPCPK ARHLKFAAAYNLGRAYYEGKGVKRSNEEAERLWLIAADNGNPKASVKAQS MLGLYYSTKEPKELEKAFYWHSEACGNGNLESQGALGLMYLYGQGIRQDT EAALQCLREAAERGNVYAQGNLVEYYYKMKFFTKCVAFSKRIADYDEVHD IPMIAQVTDCLPEFIGRGMAMASFYHARCLQLGLGITRDETTAKHYYSKA CRLNPALADELHSLLIRQRI

  • Molecular Weight

    42 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LRP2BP (LRP2 binding protein) has emerged as a significant focus in molecular biology due to its role in intercellular signaling and its potential implications in various diseases, particularly cancer. Initially identified as a binding partner for the low-density lipoprotein receptor-related protein 2 (LRP2), LRP2BP is believed to modulate the signaling pathways that govern cell growth, differentiation, and migration. Its interaction with LRP2 suggests a crucial role in the regulation of endocytosis and cellular communication. Moreover, studies have indicated that alterations in LRP2BP expression may be associated with tumor progression and metastasis, making it a candidate for therapeutic targeting. Recent advancements in recombinant protein technology have facilitated the production of LRP2BP in sufficient quantities for structural and functional analysis, allowing researchers to decipher its molecular mechanisms. Understanding how LRP2BP influences cellular processes can provide insights into its potential as a biomarker for disease progression and a target for novel therapeutic strategies. As research continues to unravel the complexities of LRP2BP's role in health and disease, it holds promise for contributing to the development of targeted treatments and improving patient outcomes in conditions where LRP2BP is implicated.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US