Analytical Data
-
Gene name
ADT
- Application
-
Alternative Names
ADT；AAC1；ANT1；ADP/ATP translocase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43716
-
Expression Region
1-136aa
-
AA Sequence
MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
-
Molecular Weight
42.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ADT (Antibody-Drug Conjugates) represent a promising approach in targeted cancer therapy, combining the specificity of monoclonal antibodies with the cytotoxic potential of therapeutic drugs. The objective of ADT research is to enhance the efficacy and reduce the systemic toxicity typically associated with conventional chemotherapy. The first generation of ADTs showed significant potential but faced challenges, including off-target effects and limited therapeutic windows. Recent advancements in protein engineering, linker technology, and drug payloads have led to the development of next-generation ADTs aimed at improving tumor targeting and overcoming resistance mechanisms. Furthermore, the integration of novel biomarkers in patient stratification is transforming ADT design, enabling personalized treatment regimens that optimize outcomes. Researchers are increasingly focused on understanding the mechanisms of action, resistance pathways, and the tumor microenvironment's influence on ADT efficacy. This research is crucial for addressing clinical challenges and broadening the application of ADTs across various cancer types. As a result, the exploration of ADT recombinant proteins is at the forefront of oncology, highlighting the need for continued innovation in protein design and therapeutic strategies to maximize the potential of this targeted therapy in clinical settings.
