Analytical Data
-
Gene name
LGALS14
- Application
-
Alternative Names
LGALS14;PPL13;Placental Protein 13-like
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8TCE9
-
Expression Region
1-139aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMGSMSSLPVPYTLPVSLPVGSCVIITGTPI LTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSRVFGIWRYEEK CYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVL RDISLTRVLISD
-
Molecular Weight
19 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LGALS14, also known as Galectin-14, is a member of the galectin family, a group of carbohydrate-binding proteins involved in numerous biological processes, including cell adhesion, migration, proliferation, and apoptosis. It is primarily expressed in the reproductive tissues and is thought to play a crucial role in various physiological and pathological conditions such as fertility, immune response, and tumor progression. The study of LGALS14 recombinant protein has gained significance due to its potential implications in understanding reproductive biology and its therapeutic applications. Researchers aim to explore the structural and functional properties of LGALS14, elucidating its interaction with glycoproteins and glycolipids, as well as its involvement in cell signaling pathways. Additionally, the recombinant form of LGALS14 can serve as a valuable tool for investigating its specific roles in diseases and developing novel diagnostic and treatment strategies. As the interest in galectins grows, LGALS14 stands out due to its unique characteristics and potential impact on reproductive health and cancer research, making it a focal point for ongoing studies and biotechnological advancements.











