Cat: PA2000-4555

Recombinant Human H295N Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    H295N

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    H295N

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    A0A1U8JT65

  • Expression Region

    1-313aa

  • AA Sequence

    MTSDGATSTPAPRRKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVEDDGTTYRKGCKPPPIDIGGSSSKITPFSSQNPSPLSSAFPSPIPSCQVSPSSSSYPSPTRFDANNPSTLLPFLRNAIPSSLPPLRISNSAPVTPPLSSPTSRNPKPLPNWETIAKESMASFNYPFYAVSAPASPTHRHFHAPATIPECDESDTSTVESGQWISFQKFAPSTSQVPTSPTFFKLVKHLPPQNLHNDLGVKDKGRGAEFEFESGHLKPWEGERINDIGMDDLELTLGSGKPQC

  • Molecular Weight

    48.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

H295N cells, derived from human adrenal cortex, have emerged as a pivotal model for studying steroidogenesis and adrenal function, particularly in the context of adrenal hyperplasia and tumorigenesis. Research into the H295N recombinant protein focuses on its role in the synthesis of various steroid hormones such as cortisol, aldosterone, and androgens, which are critical for numerous physiological processes. These cells maintain a steroidogenic phenotype, retaining the expression of key enzymes involved in the biosynthesis of adrenal steroids, making them a valuable tool for investigating the mechanisms underlying adrenal disorders. Moreover, the study of H295N cells has implications in understanding the pathophysiology of conditions like Cushing's syndrome and congenital adrenal hyperplasia, offering insights into potential therapeutic targets. The recombinant proteins produced by H295N cells can also facilitate the development of biochemical assays and drug screening processes, ultimately contributing to advancements in endocrine research and therapeutics. As researchers delve deeper into the molecular pathways regulated by these proteins, they aim to uncover new strategies for diagnosing and treating adrenal-related diseases, enhancing the precision of therapeutic interventions in clinical settings. The ongoing exploration of H295N recombinant proteins represents a significant step forward in endocrinology, bridging the gap between basic science and clinical application.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US