Analytical Data
-
Gene name
ANP32A
- Application
-
Alternative Names
ANP32A；E4F；Transcription factor E4F1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P39687
-
Expression Region
1-249aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMEMGRRIHLELRNRTPSDVKELVLDNSRSN EGKLEGLTDEFEELEFLSTINVGLTSIANLPKLNKLKKLELSDNRVSGGL EVLAEKCPNLTHLNLSGNKIKDLSTIEPLKKLENLKSLDLFNCEVTNLND YRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDEEEDEDEEEYD EDAQVVEDEEDEDEEEEGEEEDVSGEEEEDEEGYNDGEVDDEEDEEELGE EERGQKRKREPEDEGEDDD
-
Molecular Weight
31 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ANP32A, a member of the acidic nucleic acid phosphoprotein (ANP) family, plays a crucial role in various cellular processes, including cell proliferation, differentiation, and response to stress. Research on ANP32A has gained momentum due to its involvement in the regulation of important signaling pathways and its potential implications in cancer biology and neurodegenerative diseases. This protein is known to interact with several key proteins, influencing processes such as apoptosis and cellular metabolism. Its dysregulation has been linked to various pathological conditions, making ANP32A a target of interest for therapeutic interventions. Recent studies focusing on the recombinant expression of ANP32A aim to elucidate its structure-function relationships and to develop potential biomarkers or therapeutic agents for diseases where ANP32A is implicated. Understanding the biological functions and mechanisms of ANP32A requires further exploration of its recombinant forms, which can be utilized in high-throughput screening and drug development, providing insights that could lead to novel treatments for diseases characterized by aberrant ANP32A activity. The growing body of research underscores the importance of ANP32A in cellular homeostasis and its potential as a target for innovative therapeutic strategies.
