Analytical Data
-
Gene name
HIST1H1D
- Application
-
Alternative Names
HIST1H1D;H1F3;HIST1H1D;Histone H1.3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P16402
-
Expression Region
2-221aa
-
AA Sequence
SETAPLAPTIPAPAEKTPVKKKAKKAGATAGKRKASGPPVSELITKAVAASKERSGVSLAALKKALAAAGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKAASGEGKPKAKKAGAAKPRKPAGAAKKPKKVAGAATPKKSIKKTPKKVKKPATAAGTKKVAKSAKKVKTPQPKKAAKSPAKAKAPKPKAAKPKSGKPKVTKAKKAAPKKK
-
Molecular Weight
66.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
HIST1H1D is a member of the histone H1 family, which plays a critical role in the packaging of DNA into nucleosomes, thereby influencing chromatin structure and function. As a linker histone, HIST1H1D is essential for stabilizing the higher-order structure of chromatin, which in turn regulates processes such as gene expression, DNA replication, and repair. Understanding the function and regulation of HIST1H1D is crucial, as abnormalities in histone modifications and expression are often linked to various diseases, including cancer. Recent studies have focused on the reconstitution of HIST1H1D as a recombinant protein to facilitate in-depth analysis of its biochemical properties and interactions with other chromatin-associated proteins. This research aims to elucidate the functional mechanisms of HIST1H1D in chromatin dynamics and its impact on gene regulatory networks. By employing techniques such as X-ray crystallography, nuclear magnetic resonance (NMR), and mass spectrometry, researchers are aiming to uncover the structural features and dynamic behavior of this histone variant. Investigating HIST1H1D not only provides insights into its role in chromatin organization but also enhances our understanding of how histone variants contribute to cellular responses under different physiological conditions. Consequently, this research holds the potential to inform therapeutic strategies targeting epigenetic modifications in diseases where histone dysregulation is implicated.











